PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013601523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 441aa    MW: 49666.1 Da    PI: 5.4646
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013601523.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.25.8e-082963272354
                     SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     r p+++e+  LAk+++L+++qV +WF N R +
  XP_013601523.1 296 RSPKESEKMMLAKQTRLSKNQVANWFINARVR 327
                     789***************************88 PP

2BELL112.91.7e-36196267172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kkakLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hF +L+dai+++i
  XP_013601523.1 196 ERQELQSKKAKLLTMVDEVDKRYNQYYHQMEALASSFEVVAGFGSAKPYTSVALNRISCHFCSLRDAIKKHI 267
                     79*******************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-46131265IPR006563POX domain
PfamPF075265.1E-45136263IPR006563POX domain
SMARTSM003890.0042290335IPR001356Homeobox domain
SuperFamilySSF466893.29E-10297338IPR009057Homeodomain-like
PROSITE profilePS500719.847298331IPR001356Homeobox domain
PfamPF059202.7E-10298327IPR008422Homeobox KN domain
CDDcd000861.45E-6298332No hitNo description
Gene3DG3DSA:1.10.10.603.3E-15298337IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MCLQEPIYLN HHHHQQQQQP SSSSSAAASF IGGEEIVRNE MVFSPPTGLQ NLNGDVPVSS  60
SELTFRDGQG LSLSLLGTQF SLPSFHYQQY QSGFTTNPPI SVQETPLFSK EMLLLGQSDP  120
SSGYGGVYNS YNMSSVLRSR YLKPAQGLLD EVVSVEKELN QMRRKKKGET FNNSANETEG  180
GGGFGGEISI ELSTIERQEL QSKKAKLLTM VDEVDKRYNQ YYHQMEALAS SFEVVAGFGS  240
AKPYTSVALN RISCHFCSLR DAIKKHIQVI REKLKEKGGE LSLDEQQGGE RIPRLRSPKE  300
SEKMMLAKQT RLSKNQVANW FINARVRLWK PMIEEMYKEE FGDDASELLT SKSPNSTNQE  360
DSSQQQQPEN TTNVAFSSEP KPDCTSANED DPQLHQMNRS ADYDSLVNYH GFDVDDYRYI  420
DGNNQQESRF SNGHHLHDFV V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705082e-97AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601523.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A0D3DQF90.0A0A0D3DQF9_BRAOL; Uncharacterized protein
STRINGBra016497.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.31e-171BEL1-like homeodomain 10